Skip to content

Shen-Lab/Structure-informed_PLM

 
 

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

11 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Table of Contents

Installation

Use conda command to set up the environment with necessary dependencies.

conda env create -f environment.yml

We support cross-machine parallel training and mixed percision training for our models. You need to install Apex in order to use these features. Please install Apex with CUDA and C++ extensions. GCC library is required for compiling Apex. We recommend version 9.3.0 and 10.3.0 which have been tested working.

Updates: The latest master branch may give failures in setting up cpp extensions and cuda extensions. Check this issue from Apex for a potential solution.

Data and model Availability

Processed data in LMDB format and model weights can be downlaoded from Zenodo

Data:

  • domain sequences for pretraining
  • family homologous sequences for sequence-only finetuning
  • family sequences+structures for structure-informed finetuning
  • fitness labels from DMS assays

Model weights:

  • pretrained meta models
  • sequence-only finetuned models
  • structure-informed finetuned models

Meta model architecture hyperparams

model id training set # layers # heads hidden size FF
RP75_B1 pfam_rp75 12 12 768 3072
RP15_B1 pfam_rp15 12 12 768 3072
RP15_B2 pfam_rp15 6 12 768 3072
RP15_B3 pfam_rp15 4 8 768 3072
RP15_B4 pfam_rp15 4 8 768 1024

Tasks

Sequence embedding

  1. Prepare sequence data

For each sequence, save the information of identifier and amino acids in the dictionary format, follow the example below. And append all such dictionaries to a List (e.g. named data_list).

{'seq_id': 'protein_seq_1' # change to your identifier, unique for each sequence
 'seq_primary': 'VQLVQSGAAVKKPGESLRISCKGSGYIFTNYWINWVRQMPGRGLEWMGRIDPSDSYTNYSSSFQGHVTISADKSISTVYLQWRSLKDTDTAMYYCARLGSTA' # string, upper cases
 }

Then, use the following code to save into lmdb format.

import lmdb
import pickle as pkl

map_size = (1024 * 15) * (2 ** 20) # 15G, change accordingly
wrtEnv = lmdb.open('/path/to/dataset/data_file_name.lmdb',map_size=map_size)
with wrtEnv.begin(write=True) as txn:
    for i, entry in enumerate(data_list): # data_list contains all dictionaries in the above format
        txn.put(str(i).encode(), pkl.dumps(entry))
    txn.put(b'num_examples', pkl.dumps(i+1))
wrtEnv.close()
  1. Run model

Run the following command to generate embeddings. If you use any relative path inputs for some parameters, make sure it is visible under the 'ProteinEncoder-LM/' folder. Please change parameters in '{}' accordingly (delete '{}' and comments afterwards)

python scripts/main.py \
    run_eval \
    transformer \
    embed_seq \
    {'/path/to/saved_model'}  (e.g. 'trained_models/rp15_pretrain_1_models') \
    --batch_size {4} (change accordingly) \
    --data_dir {'/path/to/dataset'} \
    --metrics save_embedding \
    --split {'data_file_name'} \
    --embed_modelNm {'customized identifier for the model'} (e.g. 'rp15_pretrain_1')

For a sequence of length L, the final embeddings have size L * 768. After successful running of the python command, a json file 'embedding_{data_file_name}_{embed_modelNm}.json' should appear under the folder '/path/to/dataset'. Sequence identifiers and embeddings are organized in the dictionary format below.

{seq_id : embedding_matrix} // seq_id is the given identifier for the sequence, embedding_matrix is a list with size L * 768.

Variant fitness

  1. Information
  • Log ratio of likelihood: $\textup{log}_{e} \frac{p(\textup{mut})}{p(\textup{wt})}$ is used as fitness prediction. More positive value means better than WT and more negative value means worse than WT.
  1. Prepare mutation data

For each mutation, follow the example below to save information in dictionary, then append all such dictionaries to a List (e.g. named data_list).

{'set_nm': 'mutation_set_1', # mutation set name
 'wt_seq': 'VQLVQSGAAVKKPGESLRIS', # WT seq (upper cases)
 'mut_seq':'SQLVQSGADVKKPGESLRIS', # Mut seq (upper cases),
 'mutants': ['V10S','A18D'], # list of mutant names (missense mutations only)
 'mut_relative_idxs' [0,8], # list of mutant indices, relative to the wt_seq (0-based)
 'fitness': 1.5 # fitness score. If given, will calcualte Spearman's r and Pearson's r; use 0 if unknown
}

Then, use the following code to save into lmdb format.

import lmdb
import pickle as pkl

map_size = (1024 * 15) * (2 ** 20) # 15G, change accordingly
wrtEnv = lmdb.open('/path/to/dataset/data_file_name.lmdb',map_size=map_size)
with wrtEnv.begin(write=True) as txn:
    for i, entry in enumerate(data_list): # data_list contains all dictionaries in the above format
        txn.put(str(i).encode(), pkl.dumps(entry))
    txn.put(b'num_examples', pkl.dumps(i+1))
wrtEnv.close()
  1. Run models Run the following command to predict mutation fitness. If you use any relative path inputs for some parameters, make sure it is visible under the 'ProteinEncoder-LM/' folder. Please change parameters in '{}' accordingly (delete '{}' and comments afterwards)
python scripts/main.py \
    run_eval \
    transformer \
    mutation_fitness_UNsupervise_mutagenesis \
    {'/path/to/saved_model'}  (e.g. 'trained_models/rp15_pretrain_1_models') \
    --batch_size {4} (change accordingly) \
    --data_dir {'/path/to/dataset'} \
    --metrics fitness_unsupervise_mutagenesis \
    --mutgsis_set {'data_file_name'} (e.g. 'mutation_set_1') \
    --embed_modelNm {'customized identifier for the model'} (e.g. 'rp15_pretrain_1')

If run command successfully, a csv file named '{data_file_name}_{embed_modelNm}predictions.csv' should appear under the folder '/path/to/dataset' which contains predicted fitness scores for each mutation. If groundtruth fitness scores are given, a json file named '{data_file_name}{embed_modelNm}_metrics.json' will be generated which contains metric values.

Structure-informed finetuning

Required packages:

  • DSSP, run mkdssp -h to verify.
  • MMseq2, run mmseqs easy-linclust -h to verify.
  • HMMER, run esl-reformat -h to verify.

Required database files:

  • accession_ids.csv from ftp of Alphafold Database
  • batch_download.sh from RCSB

Training data generation

Given a target protein sequence, the first step is to query its homologous sequences using EVcouplings, please follow instructions on their Github repo. It is recommended to explore multiple bit score thresholds and select the best one as ellaborated in Appendix.C of Tranception.

With the acquired MSA, generate training data of sequences and structures with the following command

python

About

Protein language modeling with information from structures

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

No packages published

Languages

  • Python 100.0%